SCOPe 2.05: Domain d1fonb_: 1fon B:

Lineage for d1fonb_ (1fon B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Procarboxypeptidase A-S6 subunit III (zymogen E) [50534] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50535] (2 PDB entries)

8. Domain d1fonb_: 1fon B: [26232]

Details for d1fonb_

PDB Entry: 1fon, 1.7 Å

PDB Description: crystal structure of bovine procarboxypeptidase a-s6 subunit iii, a highly structured truncated zymogen e

PDB Compounds: (B:) procarboxypeptidase a-s6

SCOPe Domain Sequences for d1fonb_:

Sequence; same for both SEQRES and ATOM records:

>d1fonb_ b.47.1.2 (B:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]}
swswqvslqyekdgafhhtcggsliapdwvvtaghcistsrtyqvvlgeydrsvlegseq
vipinagdlfvhplwnsncvacgndialvklsrsaqlgdkvqlanlppagdilpneapcy
isgwgrlytggplpdklqqallptvdyehcsqwdwwgitvkktmvcaggdtrsgcngdsg
gplncpaadgswqvhgvtsfvsafgcntikkptvftrvsafidwidetiasn

Timeline for d1fonb_:

• d1fonb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fonb_ appears in SCOPe 2.04
  
• d1fonb_ appears in SCOPe 2.06
  
• d1fonb_ appears in the current release, SCOPe 2.08