Lineage for d3l74r1 (3l74 R:1-69)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958070Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 1958120Family f.23.12.0: automated matches [254198] (1 protein)
    not a true family
  6. 1958121Protein automated matches [254432] (4 species)
    not a true protein
  7. 1958124Species Chicken (Gallus gallus) [TaxId:9031] [260678] (8 PDB entries)
  8. 1958132Domain d3l74r1: 3l74 R:1-69 [262307]
    Other proteins in same PDB: d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74c2, d3l74d1, d3l74d2, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_
    automated match to d3l70e1
    complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq

Details for d3l74r1

PDB Entry: 3l74 (more details), 2.76 Å

PDB Description: cytochrome bc1 complex from chicken with famoxadone bound
PDB Compounds: (R:) cytochrome b-c1 complex subunit 5, rieske ironsulfur protein, mitochondrial

SCOPe Domain Sequences for d3l74r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l74r1 f.23.12.0 (R:1-69) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
vhndvtvpdfsayrredvmdattssqtssedrkgfsylvtatacvatayaaknvvtqfis
slsasadvl

SCOPe Domain Coordinates for d3l74r1:

Click to download the PDB-style file with coordinates for d3l74r1.
(The format of our PDB-style files is described here.)

Timeline for d3l74r1: