Lineage for d1a0h.2 (1a0h D:271-320,E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405313Protein Thrombin [50531] (2 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
    Uniprot P00734 333-622
  8. 2405348Domain d1a0h.2: 1a0h D:271-320,E: [26230]
    Other proteins in same PDB: d1a0ha1, d1a0hd1
    complexed with 0g6

Details for d1a0h.2

PDB Entry: 1a0h (more details), 3.2 Å

PDB Description: the x-ray crystal structure of ppack-meizothrombin desf1: kringle/thrombin and carbohydrate/kringle/thrombin interactions and location of the linker chain
PDB Compounds: (D:) meizothrombin, (E:) meizothrombin

SCOPe Domain Sequences for d1a0h.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1a0h.2 b.47.1.2 (D:271-320,E:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
rtsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaev
glspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrt
ryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakl
lhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcag
ykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkw
iqkvidrlgs

SCOPe Domain Coordinates for d1a0h.2:

Click to download the PDB-style file with coordinates for d1a0h.2.
(The format of our PDB-style files is described here.)

Timeline for d1a0h.2: