SCOPe 2.07: Domain d3l71e2: 3l71 E:70-196

Lineage for d3l71e2 (3l71 E:70-196)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)

6. Protein automated matches [190874] (7 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [260680] (8 PDB entries)

8. Domain d3l71e2: 3l71 E:70-196 [262294]
   Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71d2, d3l71e1, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71r1, d3l71s_, d3l71t_, d3l71u_, d3l71w_
   automated match to d3l70e2
   complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71e2

PDB Entry: 3l71, 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound

PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d3l71e2:

Sequence; same for both SEQRES and ATOM records:

>d3l71e2 b.33.1.1 (E:70-196) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
alskieiklsdipegknvafkwrgkplfvrhrtqaeinqeaevdvsklrdpqhdldrvkk
pewvilvgvcthlgcvpiansgdfggyycpchgshydasgrirkgpapynlevptyqfvg
ddlvvvg

Timeline for d3l71e2:

• d3l71e2 first appeared in SCOPe 2.05
  
• d3l71e2 appears in SCOPe 2.06
  
• d3l71e2 appears in the current release, SCOPe 2.08