Lineage for d3l71e1 (3l71 E:1-69)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631229Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 2631284Family f.23.12.0: automated matches [254198] (1 protein)
    not a true family
  6. 2631285Protein automated matches [254432] (4 species)
    not a true protein
  7. 2631290Species Chicken (Gallus gallus) [TaxId:9031] [260678] (8 PDB entries)
  8. 2631297Domain d3l71e1: 3l71 E:1-69 [262293]
    Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71d2, d3l71e2, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71r2, d3l71s_, d3l71t_, d3l71u_, d3l71w_
    automated match to d3l70e1
    complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71e1

PDB Entry: 3l71 (more details), 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound
PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d3l71e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l71e1 f.23.12.0 (E:1-69) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
vhndvtvpdfsayrredvmdattssqtssedrkgfsylvtatacvatayaaknvvtqfis
slsasadvl

SCOPe Domain Coordinates for d3l71e1:

Click to download the PDB-style file with coordinates for d3l71e1.
(The format of our PDB-style files is described here.)

Timeline for d3l71e1: