SCOPe 2.06: Domain d1a0h.1: 1a0h A:271-320,B:

Lineage for d1a0h.1 (1a0h A:271-320,B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
   Uniprot P00734 333-622

8. Domain d1a0h.1: 1a0h A:271-320,B: [26229]
   Other proteins in same PDB: d1a0ha1, d1a0hd1
   complexed with 0g6

Details for d1a0h.1

PDB Entry: 1a0h, 3.2 Å

PDB Description: the x-ray crystal structure of ppack-meizothrombin desf1: kringle/thrombin and carbohydrate/kringle/thrombin interactions and location of the linker chain

PDB Compounds: (A:) meizothrombin, (B:) meizothrombin

SCOPe Domain Sequences for d1a0h.1:

Sequence; same for both SEQRES and ATOM records:

>g1a0h.1 b.47.1.2 (A:271-320,B:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
rtsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaev
glspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrt
ryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakl
lhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcag
ykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkw
iqkvidrlgs

Timeline for d1a0h.1:

• d1a0h.1 first appeared (with stable ids) in SCOP 1.55
  
• d1a0h.1 appears in SCOPe 2.05
  
• d1a0h.1 appears in SCOPe 2.07
  
• d1a0h.1 appears in the current release, SCOPe 2.08