Lineage for d3h1hr2 (3h1h R:70-196)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391958Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2391959Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2391960Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2392045Protein automated matches [190874] (7 species)
    not a true protein
  7. 2392050Species Chicken (Gallus gallus) [TaxId:9031] [260680] (8 PDB entries)
  8. 2392064Domain d3h1hr2: 3h1h R:70-196 [262285]
    Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_
    automated match to d3l70e2
    complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1hr2

PDB Entry: 3h1h (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (R:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d3h1hr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1hr2 b.33.1.1 (R:70-196) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
alskieiklsdipegknvafkwrgkplfvrhrtqaeinqeaevdvsklrdpqhdldrvkk
pewvilvgvcthlgcvpiansgdfggyycpchgshydasgrirkgpapynlevptyqfvg
ddlvvvg

SCOPe Domain Coordinates for d3h1hr2:

Click to download the PDB-style file with coordinates for d3h1hr2.
(The format of our PDB-style files is described here.)

Timeline for d3h1hr2: