![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
![]() | Protein automated matches [190874] (7 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [260680] (8 PDB entries) |
![]() | Domain d3h1hr2: 3h1h R:70-196 [262285] Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_ automated match to d3l70e2 complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq |
PDB Entry: 3h1h (more details), 3.16 Å
SCOPe Domain Sequences for d3h1hr2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1hr2 b.33.1.1 (R:70-196) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} alskieiklsdipegknvafkwrgkplfvrhrtqaeinqeaevdvsklrdpqhdldrvkk pewvilvgvcthlgcvpiansgdfggyycpchgshydasgrirkgpapynlevptyqfvg ddlvvvg
Timeline for d3h1hr2:
![]() Domains from other chains: (mouse over for more information) d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_ |