Lineage for d3h1hr1 (3h1h R:1-69)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631229Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 2631284Family f.23.12.0: automated matches [254198] (1 protein)
    not a true family
  6. 2631285Protein automated matches [254432] (4 species)
    not a true protein
  7. 2631290Species Chicken (Gallus gallus) [TaxId:9031] [260678] (8 PDB entries)
  8. 2631304Domain d3h1hr1: 3h1h R:1-69 [262284]
    Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_
    automated match to d3l70e1
    complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1hr1

PDB Entry: 3h1h (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (R:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d3h1hr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1hr1 f.23.12.0 (R:1-69) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
vhndvtvpdfsayrredvmdattssqtssedrkgfsylvtatacvatayaaknvvtqfis
slsasadvl

SCOPe Domain Coordinates for d3h1hr1:

Click to download the PDB-style file with coordinates for d3h1hr1.
(The format of our PDB-style files is described here.)

Timeline for d3h1hr1: