SCOPe 2.06: Domain d3gr8a_: 3gr8 A:

Lineage for d3gr8a_ (3gr8 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.0: automated matches [191310] (1 protein)
   not a true family

6. Protein automated matches [190048] (21 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [259353] (2 PDB entries)

8. Domain d3gr8a_: 3gr8 A: [262281]
   automated match to d3gr7a_
   complexed with btb, fmn, so4

Details for d3gr8a_

PDB Entry: 3gr8, 2.5 Å

PDB Description: Structure of OYE from Geobacillus kaustophilus, orthorhombic crystal form

PDB Compounds: (A:) NADPH dehydrogenase

SCOPe Domain Sequences for d3gr8a_:

Sequence; same for both SEQRES and ATOM records:

>d3gr8a_ c.1.4.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
mntmlfspytirgltlknrivmspmcmyscdtkdgavrtwhkihyparavgqvgliivea
tgvtpqgriserdlgiwsddhiaglrelvglvkehgaaigiqlahagrksqvpgeiiaps
avpfddssptpkemtkadieetvqafqngarrakeagfdvieihaahgylineflsplsn
rrqdeyggspenryrflgevidavrevwdgplfvrisasdyhpdgltakdyvpyakrmke
qgvdlvdvssgaivparmnvypgyqvpfaelirreadiptgavglitsgwqaeeilqngr
adlvflgrellrnpywpyaaarelgakisapvqyergwrf

Timeline for d3gr8a_:

• d3gr8a_ first appeared in SCOPe 2.05
  
• d3gr8a_ appears in SCOPe 2.07
  
• d3gr8a_ appears in the current release, SCOPe 2.08