Lineage for d1toc.4 (1toc G:,H:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561477Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 561478Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 561609Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 562018Protein Thrombin [50531] (2 species)
  7. 562019Species Cow (Bos taurus) [TaxId:9913] [50533] (26 PDB entries)
  8. 562062Domain d1toc.4: 1toc G:,H: [26228]
    Other proteins in same PDB: d1tocr1, d1tocr2, d1tocs1, d1tocs2, d1toct1, d1toct2, d1tocu1, d1tocu2

Details for d1toc.4

PDB Entry: 1toc (more details), 3.1 Å

PDB Description: structure of serine proteinase

SCOP Domain Sequences for d1toc.4:

Sequence; same for both SEQRES and ATOM records: (download)

>g1toc.4 b.47.1.2 (G:,H:) Thrombin {Cow (Bos taurus)}
adcglrplfekkqvqdqtekelfesyieXivegqdaevglspwqvmlfrkspqellcgas
lisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldkiyihpryn
wkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgnrretwtts
vaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfvm
kspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs

SCOP Domain Coordinates for d1toc.4:

Click to download the PDB-style file with coordinates for d1toc.4.
(The format of our PDB-style files is described here.)

Timeline for d1toc.4: