Lineage for d3crlb2 (3crl B:178-404)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973930Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)
  6. 2973980Protein automated matches [230554] (2 species)
    not a true protein
  7. 2973990Species Norway rat (Rattus norvegicus) [TaxId:10116] [233755] (2 PDB entries)
  8. 2973994Domain d3crlb2: 3crl B:178-404 [262279]
    Other proteins in same PDB: d3crla1, d3crlb1, d3crlc_, d3crld_
    automated match to d4mpca2
    complexed with anp, k, mg

Details for d3crlb2

PDB Entry: 3crl (more details), 2.61 Å

PDB Description: crystal structure of the pdhk2-l2 complex.
PDB Compounds: (B:) Pyruvate dehydrogenase [lipoamide] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d3crlb2:

Sequence, based on SEQRES records: (download)

>d3crlb2 d.122.1.4 (B:178-404) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gstnpahpkhigsidpncsvsdvvkdaydmakllcdkyymaspdleiqevnatnatqpih
mvyvpshlyhmlfelfknamratveshessltlppikimvalgeedlsikmsdrgggvpl
rkierlfsymystaptpqpgtggtplagfgyglpisrlyakyfqgdlqlfsmegfgtdav
iylkalstdsverlpvynksawrhyqtiqeagdwcvpstepkntsty

Sequence, based on observed residues (ATOM records): (download)

>d3crlb2 d.122.1.4 (B:178-404) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gstnpahpkhigsidpncsvsdvvkdaydmakllcdkyymaspdleiqevnatnatqpih
mvyvpshlyhmlfelfknamratveshessltlppikimvalgeedlsikmsdrgggvpl
rkierlfsymystaplagfgyglpisrlyakyfqgdlqlfsmegfgtdaviylkalstds
verlpvynksawrhyqtiqeagdwcvpstepkntsty

SCOPe Domain Coordinates for d3crlb2:

Click to download the PDB-style file with coordinates for d3crlb2.
(The format of our PDB-style files is described here.)

Timeline for d3crlb2: