Lineage for d3crkb1 (3crk B:12-177)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708719Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 2708720Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)
  6. 2708739Protein automated matches [230549] (2 species)
    not a true protein
  7. 2708768Species Norway rat (Rattus norvegicus) [TaxId:10116] [267826] (2 PDB entries)
  8. 2708770Domain d3crkb1: 3crk B:12-177 [262274]
    Other proteins in same PDB: d3crka2, d3crkb2, d3crkc_, d3crkd_
    automated match to d4mpca1
    complexed with k

Details for d3crkb1

PDB Entry: 3crk (more details), 2.3 Å

PDB Description: crystal structure of the pdhk2-l2 complex.
PDB Compounds: (B:) Pyruvate dehydrogenase [lipoamide] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d3crkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3crkb1 a.29.5.1 (B:12-177) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
slagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinll
pdrvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptma
qgvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

SCOPe Domain Coordinates for d3crkb1:

Click to download the PDB-style file with coordinates for d3crkb1.
(The format of our PDB-style files is described here.)

Timeline for d3crkb1: