| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) ![]() automatically mapped to Pfam PF10436 |
| Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins) |
| Protein automated matches [230549] (2 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [267826] (2 PDB entries) |
| Domain d3crkb1: 3crk B:12-177 [262274] Other proteins in same PDB: d3crka2, d3crkb2, d3crkc_, d3crkd_ automated match to d4mpca1 complexed with k |
PDB Entry: 3crk (more details), 2.3 Å
SCOPe Domain Sequences for d3crkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3crkb1 a.29.5.1 (B:12-177) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
slagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinll
pdrvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptma
qgvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd
Timeline for d3crkb1:
View in 3DDomains from other chains: (mouse over for more information) d3crka1, d3crka2, d3crkc_, d3crkd_ |