Lineage for d3crka2 (3crk A:185-402)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580489Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)
  6. 2580539Protein automated matches [230554] (2 species)
    not a true protein
  7. 2580549Species Norway rat (Rattus norvegicus) [TaxId:10116] [233755] (2 PDB entries)
  8. 2580550Domain d3crka2: 3crk A:185-402 [262273]
    Other proteins in same PDB: d3crka1, d3crkb1, d3crkc_, d3crkd_
    automated match to d4mpca2
    complexed with k

Details for d3crka2

PDB Entry: 3crk (more details), 2.3 Å

PDB Description: crystal structure of the pdhk2-l2 complex.
PDB Compounds: (A:) Pyruvate dehydrogenase [lipoamide] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d3crka2:

Sequence, based on SEQRES records: (download)

>d3crka2 d.122.1.4 (A:185-402) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pkhigsidpncsvsdvvkdaydmakllcdkyymaspdleiqevnatnatqpihmvyvpsh
lyhmlfelfknamratveshessltlppikimvalgeedlsikmsdrgggvplrkierlf
symystaptpqpgtggtplagfgyglpisrlyakyfqgdlqlfsmegfgtdaviylkals
tdsverlpvynksawrhyqtiqeagdwcvpstepknts

Sequence, based on observed residues (ATOM records): (download)

>d3crka2 d.122.1.4 (A:185-402) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pkhigsidpncsvsdvvkdaydmakllcdkyymaspdleiqevnatnatqpihmvyvpsh
lyhmlfelfknamratveshessltlppikimvalgeedlsikmsdrgggvplrkierlf
symystapgyglpisrlyakyfqgdlqlfsmegfgtdaviylkalstdsverlpvynksa
wrhyqtiqeagdwcvpstepknts

SCOPe Domain Coordinates for d3crka2:

Click to download the PDB-style file with coordinates for d3crka2.
(The format of our PDB-style files is described here.)

Timeline for d3crka2: