Lineage for d3bopb_ (3bop B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779532Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2779614Protein automated matches [190380] (3 species)
    not a true protein
  7. 2779620Species Mouse (Mus musculus) [TaxId:10090] [188387] (10 PDB entries)
  8. 2779642Domain d3bopb_: 3bop B: [262265]
    Other proteins in same PDB: d3bopa2, d3bopc2
    automated match to d3bopa_

Details for d3bopb_

PDB Entry: 3bop (more details), 3 Å

PDB Description: Structure of mouse beta-neurexin 2D4
PDB Compounds: (B:) beta-Neurexin 2D4

SCOPe Domain Sequences for d3bopb_:

Sequence, based on SEQRES records: (download)

>d3bopb_ b.29.1.4 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ttyifgkggalitytwppndrpstrmdrlavgfsthqrsavlvrvdsasglgdylqlhid
qgtvgvifnvgtdditidepnaivsdgkyhvvrftrsggnatlqvdswpvnerypagrql
tifnsqaaikiggrdqgrpfqgqvsglyynglkvlalaaesdpnvrteghlrlv

Sequence, based on observed residues (ATOM records): (download)

>d3bopb_ b.29.1.4 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ttyifgkggalitytwppndrpstrmdrlavgfsthqrsavlvrvdsasglgdylqlhid
qgtvgvifnvgtdditidepnaivsdgkyhvvrftrsggnatlqvdswpvnerypifnsq
aaikiggrdqgrpfqgqvsglyynglkvlalaaesdpnvrteghlrlv

SCOPe Domain Coordinates for d3bopb_:

Click to download the PDB-style file with coordinates for d3bopb_.
(The format of our PDB-style files is described here.)

Timeline for d3bopb_: