Lineage for d3a9qs_ (3a9q S:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2318309Species Soybean (Glycine max) [TaxId:3847] [255741] (4 PDB entries)
  8. 2318352Domain d3a9qs_: 3a9q S: [262259]
    automated match to d3a9qe_
    complexed with acy, ca

Details for d3a9qs_

PDB Entry: 3a9q (more details), 1.9 Å

PDB Description: crystal structure analysis of e173a variant of the soybean ferritin sfer4
PDB Compounds: (S:) Ferritin-4, chloroplastic

SCOPe Domain Sequences for d3a9qs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a9qs_ a.25.1.0 (S:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn
valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame
lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg
hgvwhfdqmllhe

SCOPe Domain Coordinates for d3a9qs_:

Click to download the PDB-style file with coordinates for d3a9qs_.
(The format of our PDB-style files is described here.)

Timeline for d3a9qs_: