![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (60 species) not a true protein |
![]() | Species Soybean (Glycine max) [TaxId:3847] [255741] (4 PDB entries) |
![]() | Domain d3a9qi_: 3a9q I: [262251] automated match to d3a9qe_ complexed with acy, ca |
PDB Entry: 3a9q (more details), 1.9 Å
SCOPe Domain Sequences for d3a9qi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a9qi_ a.25.1.0 (I:) automated matches {Soybean (Glycine max) [TaxId: 3847]} fepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrdn valrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalhame lalslekltnekllnlhsvatkngdvqladfveteylgaqveaikriseyvaqlrrvgkg hgvwhfdqmllhe
Timeline for d3a9qi_: