Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (120 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [226637] (8 PDB entries) |
Domain d2zzxd_: 2zzx D: [262248] automated match to d2zzxc_ complexed with ca, gol, lac, po4 |
PDB Entry: 2zzx (more details), 1.75 Å
SCOPe Domain Sequences for d2zzxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zzxd_ c.94.1.0 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} ryrwriqtawdagtvgyslfqkftervkeltdgqlevqpfpagavvgtfdmfdavktgvl dgmnpftlywagrmpvtaflssyalgldrpdqwetwfyslggldiarrafaeqglfyvgp vqhdlniihskkpirrfedfkgvklrvpggmiaevfaaagastvllpggevypalergvi daadfvgpavnynlgfhqvakyiimgppetpaihqpvdlmdftinlnrwrslpkplqerf iaavheyswihyagiqkanleawpkyrqagvevirlsnedvrkfrrlaipiwfkwakmdk ysreafasqleymkgigyvtdeelkglsl
Timeline for d2zzxd_: