Lineage for d2znvd_ (2znv D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525733Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2526149Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2526150Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
    Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
  6. 2526205Protein automated matches [267675] (2 species)
    not a true protein
  7. 2526214Species Human (Homo sapiens) [TaxId:9606] [267818] (2 PDB entries)
  8. 2526217Domain d2znvd_: 2znv D: [262245]
    Other proteins in same PDB: d2znvb_, d2znvc_, d2znve_, d2znvf_
    automated match to d3rzuc_
    complexed with edo, zn

Details for d2znvd_

PDB Entry: 2znv (more details), 1.6 Å

PDB Description: crystal structure of human amsh-lp dub domain in complex with lys63- linked ubiquitin dimer
PDB Compounds: (D:) AMSH-like protease

SCOPe Domain Sequences for d2znvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2znvd_ c.97.3.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glrcvvlpedlchkflqlaesntvrgiatcgilcgklthneftithvivpkqsagpdycd
menveelfnvqdqhdlltlgwihthptqtaflssvdlhthcsyqlmlpeaiaivcspkhk
dtgifrltnagmlevsackkkgfhphtkeprlfsickhvlvkdikiivldlr

SCOPe Domain Coordinates for d2znvd_:

Click to download the PDB-style file with coordinates for d2znvd_.
(The format of our PDB-style files is described here.)

Timeline for d2znvd_: