Lineage for d2x9ad1 (2x9a D:332-420)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006762Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
    beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer
  4. 3006763Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (3 families) (S)
  5. 3006764Family d.212.1.1: TolA [55217] (2 proteins)
    contains extra N-terminal helix
  6. 3006771Protein automated matches [267673] (2 species)
    not a true protein
  7. 3006772Species Escherichia coli [TaxId:562] [267810] (1 PDB entry)
  8. 3006774Domain d2x9ad1: 2x9a D:332-420 [262241]
    Other proteins in same PDB: d2x9aa_, d2x9ab2, d2x9ac_, d2x9ad2
    automated match to d1s62a_

Details for d2x9ad1

PDB Entry: 2x9a (more details), 2.47 Å

PDB Description: crystal structure of g3p from phage if1 in complex with its coreceptor, the c-terminal domain of tola
PDB Compounds: (D:) membrane spanning protein, required for outer membrane integrity

SCOPe Domain Sequences for d2x9ad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x9ad1 d.212.1.1 (D:332-420) automated matches {Escherichia coli [TaxId: 562]}
sgadinnyagqiksaieskfydassyagktctlriklapdgmlldikpeggdpalcqaal
aaaklakipkppsqavyevfknapldfkp

SCOPe Domain Coordinates for d2x9ad1:

Click to download the PDB-style file with coordinates for d2x9ad1.
(The format of our PDB-style files is described here.)

Timeline for d2x9ad1: