![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily) beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer |
![]() | Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (3 families) ![]() |
![]() | Family d.212.1.1: TolA [55217] (2 proteins) contains extra N-terminal helix |
![]() | Protein automated matches [267673] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [267810] (1 PDB entry) |
![]() | Domain d2x9ad1: 2x9a D:332-420 [262241] Other proteins in same PDB: d2x9aa_, d2x9ab2, d2x9ac_, d2x9ad2 automated match to d1s62a_ |
PDB Entry: 2x9a (more details), 2.47 Å
SCOPe Domain Sequences for d2x9ad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x9ad1 d.212.1.1 (D:332-420) automated matches {Escherichia coli [TaxId: 562]} sgadinnyagqiksaieskfydassyagktctlriklapdgmlldikpeggdpalcqaal aaaklakipkppsqavyevfknapldfkp
Timeline for d2x9ad1:
![]() Domains from other chains: (mouse over for more information) d2x9aa_, d2x9ab1, d2x9ab2, d2x9ac_ |