SCOPe 2.08: Domain d2x9ab1: 2x9a B:332-420

Lineage for d2x9ab1 (2x9a B:332-420)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
   beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer

4. Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (3 families)

5. Family d.212.1.1: TolA [55217] (2 proteins)
   contains extra N-terminal helix

6. Protein automated matches [267673] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [267810] (1 PDB entry)

8. Domain d2x9ab1: 2x9a B:332-420 [262240]
   Other proteins in same PDB: d2x9aa_, d2x9ab2, d2x9ac_, d2x9ad2
   automated match to d1s62a_

Details for d2x9ab1

PDB Entry: 2x9a, 2.47 Å

PDB Description: crystal structure of g3p from phage if1 in complex with its coreceptor, the c-terminal domain of tola

PDB Compounds: (B:) membrane spanning protein, required for outer membrane integrity

SCOPe Domain Sequences for d2x9ab1:

Sequence; same for both SEQRES and ATOM records:

>d2x9ab1 d.212.1.1 (B:332-420) automated matches {Escherichia coli [TaxId: 562]}
sgadinnyagqiksaieskfydassyagktctlriklapdgmlldikpeggdpalcqaal
aaaklakipkppsqavyevfknapldfkp

Timeline for d2x9ab1:

• d2x9ab1 first appeared in SCOPe 2.05, called d2x9ab_
  
• d2x9ab1 appears in SCOPe 2.07