Lineage for d1vit.2 (1vit M:,F:,G:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. Protein Thrombin [50531] (2 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
    Uniprot P00734 333-622
  8. Domain d1vit.2: 1vit M:,F:,G: [26224]
    complexed with nag

Details for d1vit.2

PDB Entry: 1vit (more details), 3.2 Å

PDB Description: thrombin:hirudin 51-65 complex
PDB Compounds: (F:) epsilon thrombin, (G:) epsilon thrombin, (M:) epsilon thrombin

SCOPe Domain Sequences for d1vit.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1vit.2 b.47.1.2 (M:,F:,G:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
tfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldk
iyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgn
rretwttXsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdace
gdsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs

SCOPe Domain Coordinates for d1vit.2 are not available.

Timeline for d1vit.2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vit.1, d1vit.1, d1vit.1, d1vit.1, d1vit.1, d1vit.1