SCOPe 2.08: Domain d2v7hb3: 2v7h B:1-121

Lineage for d2v7hb3 (2v7h B:1-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
   Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4

8. Domain d2v7hb3: 2v7h B:1-121 [262236]
   Other proteins in same PDB: d2v7ha1, d2v7ha2, d2v7hb2, d2v7hh2, d2v7hl1, d2v7hl2

Details for d2v7hb3

PDB Entry: 2v7h, 2.8 Å

PDB Description: crystal structure of an immunogen specific anti-mannopyranoside monoclonal antibody fab fragment

PDB Compounds: (B:) monoclonal antibody

SCOPe Domain Sequences for d2v7hb3:

Sequence; same for both SEQRES and ATOM records:

>d2v7hb3 b.1.1.1 (B:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
qaqlqqsgaelmkpgasvkisckatgytfsnywidwikqrpghglewigeilpgsgstny
nekfrgkatftadtssntaymqlssltsedsavyyctrrgywaydfdywgqgttltvss

Timeline for d2v7hb3:

• d2v7hb3 first appeared in SCOPe 2.05
  
• d2v7hb3 appears in SCOPe 2.07