Lineage for d2pnre3 (2pnr E:174-400)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537637Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 protein domains)
  6. 2537655Protein Pyruvate dehydrogenase kinase [69807] (2 species)
  7. 2537656Species Human (Homo sapiens) [TaxId:9606] [160702] (16 PDB entries)
    Uniprot Q15120 177-301
  8. 2537665Domain d2pnre3: 2pnr E:174-400 [262231]
    Other proteins in same PDB: d2pnra1, d2pnrb1, d2pnrc_, d2pnre1, d2pnrf1, d2pnrg_
    automated match to d2pnrb2
    complexed with red

Details for d2pnre3

PDB Entry: 2pnr (more details), 2.5 Å

PDB Description: Crystal Structure of the asymmetric Pdk3-l2 Complex
PDB Compounds: (E:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3

SCOPe Domain Sequences for d2pnre3:

Sequence, based on SEQRES records: (download)

>d2pnre3 d.122.1.4 (E:174-400) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
gdtnpvhpkhigsidptcnvadvvkdayetakmlceqyylvapeleveefnakapdkpiq
vvyvpshlfhmlfelfknsmratvelyedrkegypavktlvtlgkedlsikisdlgggvp
lrkidrlfnymystaprpsleptraaplagfgyglpisrlyaryfqgdlklysmegvgtd
aviylkalssesferlpvfnksawrhykttpeaddwsnpsseprdas

Sequence, based on observed residues (ATOM records): (download)

>d2pnre3 d.122.1.4 (E:174-400) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
gdtnpvhpkhigsidptcnvadvvkdayetakmlceqyylvapeleveefnakapdkpiq
vvyvpshlfhmlfelfknsmratvelyedrkegypavktlvtlgkedlsikisdlgggvp
lrkidrlfnyaaplagfgyglpisrlyaryfqgdlklysmegvgtdaviylkalssesfe
rlpvfnksawrhykttpeaddwsnpsseprdas

SCOPe Domain Coordinates for d2pnre3:

Click to download the PDB-style file with coordinates for d2pnre3.
(The format of our PDB-style files is described here.)

Timeline for d2pnre3: