![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Thrombin [50531] (2 species) |
![]() | Domain d1vit.1: 1vit L:,H: [26223] complexed with nag |
PDB Entry: 1vit (more details), 3.2 Å
SCOPe Domain Sequences for d1vit.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1vit.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus) [TaxId: 9913]} tfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvmlfrksp qellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldk iyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgn rretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdaceg dsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs
Timeline for d1vit.1: