Lineage for d1vit.1 (1vit L:,H:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 protein domains)
  6. 15170Protein Thrombin [50531] (2 species)
  7. 15171Species Cow (Bos taurus) [TaxId:9913] [50533] (18 PDB entries)
  8. 15197Domain d1vit.1: 1vit L:,H: [26223]

Details for d1vit.1

PDB Entry: 1vit (more details), 3.2 Å

PDB Description: thrombin:hirudin 51-65 complex

SCOP Domain Sequences for d1vit.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1vit.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus)}
tfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldk
iyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgn
rretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdaceg
dsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs

SCOP Domain Coordinates for d1vit.1:

Click to download the PDB-style file with coordinates for d1vit.1.
(The format of our PDB-style files is described here.)

Timeline for d1vit.1: