SCOPe 2.06: Domain d2p1ya2: 2p1y A:117-412

Lineage for d2p1ya2 (2p1y A:117-412)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d2p1ya2: 2p1y A:117-412 [262227]
   Other proteins in same PDB: d2p1ya1, d2p1yc1, d2p1ye1, d2p1yg1
   automated match to d2p1ye2

Details for d2p1ya2

PDB Entry: 2p1y, 2.42 Å

PDB Description: 1.B2.D9, a bispecific alpha/beta TCR

PDB Compounds: (A:) bispecific alpha/beta TCR

SCOPe Domain Sequences for d2p1ya2:

Sequence; same for both SEQRES and ATOM records:

>d2p1ya2 b.1.1.0 (A:117-412) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsaddakkdaakkdgqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpall
isilsvsdkkedgrftiffnkrekklslhiadsqpgdsatyfcaaidtnaykvifgkgth
lhvlp

Timeline for d2p1ya2:

• d2p1ya2 first appeared in SCOPe 2.05
  
• d2p1ya2 appears in SCOPe 2.07
  
• d2p1ya2 appears in the current release, SCOPe 2.08