SCOPe 2.08: Domain d2mf2b1: 2mf2 B:14-132

Lineage for d2mf2b1 (2mf2 B:14-132)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.2: Kid/PemK [82075] (4 proteins)
   automatically mapped to Pfam PF02452

6. Protein automated matches [228538] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [256429] (1 PDB entry)

8. Domain d2mf2b1: 2mf2 B:14-132 [262217]
   Other proteins in same PDB: d2mf2a2, d2mf2b2
   automated match to d2mf2a_

Details for d2mf2b1

PDB Entry: 2mf2

PDB Description: Structural and biophysical characterization of the mRNA interferase SaMazF from Staphylococcus aureus.

PDB Compounds: (B:) mRNA interferase MazF

SCOPe Domain Sequences for d2mf2b1:

Sequence; same for both SEQRES and ATOM records:

>d2mf2b1 b.34.6.2 (B:14-132) automated matches {Staphylococcus aureus [TaxId: 1280]}
irrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthvei
ekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislglnavahqkn

Timeline for d2mf2b1:

• d2mf2b1 first appeared in SCOPe 2.05, called d2mf2b_
  
• d2mf2b1 appears in SCOPe 2.07