SCOPe 2.05: Domain d2j3sa3: 2j3s A:-1-2135

Lineage for d2j3sa3 (2j3s A:-1-2135)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (43 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries)

8. Domain d2j3sa3: 2j3s A:-1-2135 [262211]
   Other proteins in same PDB: d2j3sb2
   automated match to d2j3sa1
   complexed with br, dio, gol

Details for d2j3sa3

PDB Entry: 2j3s, 2.5 Å

PDB Description: crystal structure of the human filamin a ig domains 19 to 21

PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d2j3sa3:

Sequence; same for both SEQRES and ATOM records:

>d2j3sa3 b.1.18.0 (A:-1-2135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgdasrvrvsgqglheghtfepaefiidtrdagygglslsiegpskvdintedledgtcr
vtycptepgnyiinikfadqhvpgspfsvkvt

Timeline for d2j3sa3:

• d2j3sa3 is new in SCOPe 2.05-stable
  
• d2j3sa3 appears in SCOPe 2.06
  
• d2j3sa3 appears in the current release, SCOPe 2.08