![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186988] (11 PDB entries) |
![]() | Domain d2j3sa3: 2j3s A:2045-2135 [262211] Other proteins in same PDB: d2j3sa4, d2j3sb2, d2j3sb4 automated match to d2j3sa1 complexed with br, dio, gol |
PDB Entry: 2j3s (more details), 2.5 Å
SCOPe Domain Sequences for d2j3sa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j3sa3 b.1.18.0 (A:2045-2135) automated matches {Human (Homo sapiens) [TaxId: 9606]} gdasrvrvsgqglheghtfepaefiidtrdagygglslsiegpskvdintedledgtcrv tycptepgnyiinikfadqhvpgspfsvkvt
Timeline for d2j3sa3:
![]() Domains from other chains: (mouse over for more information) d2j3sb1, d2j3sb2, d2j3sb3, d2j3sb4 |