SCOPe 2.08: Domain d2h3ha1: 2h3h A:1-305

Lineage for d2h3ha1 (2h3h A:1-305)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [255200] (2 PDB entries)

8. Domain d2h3ha1: 2h3h A:1-305 [262207]
   Other proteins in same PDB: d2h3ha2
   automated match to d2h3hb_
   complexed with bgc

Details for d2h3ha1

PDB Entry: 2h3h, 1.7 Å

PDB Description: crystal structure of the liganded form of thermotoga maritima glucose binding protein

PDB Compounds: (A:) Sugar ABC transporter, periplasmic sugar-binding protein

SCOPe Domain Sequences for d2h3ha1:

Sequence; same for both SEQRES and ATOM records:

>d2h3ha1 c.93.1.0 (A:1-305) automated matches {Thermotoga maritima [TaxId: 2336]}
mltigvigksvhpywsqveqgvkaagkalgvdtkffvpqkedinaqlqmlesfiaegvng
iaiapsdptaviptikkalemgipvvtldtdspdsgryvyigtdnyqagytaglimkell
ggkgkvvigtgsltamnslqriqgfkdaikdseieivdilndeedgaravslaeaalnah
pdldaffgvyayngpaqalvvknagkvgkvkivcfdttpdilqyvkegviqatmgqrpym
mgylsvtvlylmnkigvqntlmmlpkvkvdgkvdyvidtgvdvvtpenldeylkkmeelg
ipikf

Timeline for d2h3ha1:

• d2h3ha1 first appeared in SCOPe 2.05, called d2h3ha_
  
• d2h3ha1 appears in SCOPe 2.07