![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
![]() | Protein automated matches [190646] (77 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:2336] [255200] (2 PDB entries) |
![]() | Domain d2h3ha1: 2h3h A:1-305 [262207] Other proteins in same PDB: d2h3ha2 automated match to d2h3hb_ complexed with bgc |
PDB Entry: 2h3h (more details), 1.7 Å
SCOPe Domain Sequences for d2h3ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h3ha1 c.93.1.0 (A:1-305) automated matches {Thermotoga maritima [TaxId: 2336]} mltigvigksvhpywsqveqgvkaagkalgvdtkffvpqkedinaqlqmlesfiaegvng iaiapsdptaviptikkalemgipvvtldtdspdsgryvyigtdnyqagytaglimkell ggkgkvvigtgsltamnslqriqgfkdaikdseieivdilndeedgaravslaeaalnah pdldaffgvyayngpaqalvvknagkvgkvkivcfdttpdilqyvkegviqatmgqrpym mgylsvtvlylmnkigvqntlmmlpkvkvdgkvdyvidtgvdvvtpenldeylkkmeelg ipikf
Timeline for d2h3ha1: