Lineage for d2h32h2 (2h32 H:120-223)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (808 PDB entries)
  8. 2353305Domain d2h32h2: 2h32 H:120-223 [262206]
    Other proteins in same PDB: d2h32a_, d2h32h1
    automated match to d1dn0b2
    complexed with zn

Details for d2h32h2

PDB Entry: 2h32 (more details), 2.7 Å

PDB Description: Crystal structure of the pre-B cell receptor
PDB Compounds: (H:) immunoglobulin heavy chain

SCOPe Domain Sequences for d2h32h2:

Sequence, based on SEQRES records: (download)

>d2h32h2 b.1.1.2 (H:120-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
rggkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvplp

Sequence, based on observed residues (ATOM records): (download)

>d2h32h2 b.1.1.2 (H:120-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wsasaptlfplvscvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
qvllpskdvtdehvvckvqhpngnkeknvplp

SCOPe Domain Coordinates for d2h32h2:

Click to download the PDB-style file with coordinates for d2h32h2.
(The format of our PDB-style files is described here.)

Timeline for d2h32h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h32h1
View in 3D
Domains from other chains:
(mouse over for more information)
d2h32a_