SCOPe 2.08: Domain d2h32h2: 2h32 H:120-223

Lineage for d2h32h2 (2h32 H:120-223)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d2h32h2: 2h32 H:120-223 [262206]
   Other proteins in same PDB: d2h32a_, d2h32h1
   automated match to d1dn0b2
   complexed with zn

Details for d2h32h2

PDB Entry: 2h32, 2.7 Å

PDB Description: crystal structure of the pre-b cell receptor

PDB Compounds: (H:) immunoglobulin heavy chain

SCOPe Domain Sequences for d2h32h2:

Sequence, based on SEQRES records:

>d2h32h2 b.1.1.2 (H:120-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
rggkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvplp

Sequence, based on observed residues (ATOM records):

>d2h32h2 b.1.1.2 (H:120-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wsasaptlfplvscvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
qvllpskdvtdehvvckvqhpngnkeknvplp

Timeline for d2h32h2:

• d2h32h2 first appeared in SCOPe 2.05
  
• d2h32h2 appears in SCOPe 2.07