SCOPe 2.08: Domain d2h32h1: 2h32 H:1-119

Lineage for d2h32h1 (2h32 H:1-119)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2h32h1: 2h32 H:1-119 [262205]
   Other proteins in same PDB: d2h32h2
   automated match to d1dn0b1
   complexed with zn

Details for d2h32h1

PDB Entry: 2h32, 2.7 Å

PDB Description: crystal structure of the pre-b cell receptor

PDB Compounds: (H:) immunoglobulin heavy chain

SCOPe Domain Sequences for d2h32h1:

Sequence; same for both SEQRES and ATOM records:

>d2h32h1 b.1.1.0 (H:1-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgeslkisckgsgysftsywigwvrqmpgkglewmgiiypgdsdtry
spsfqgqvtisadksistaylqwsslkasdtamyycarhyyyyygmdvwgqgttvtvss

Timeline for d2h32h1:

• d2h32h1 first appeared in SCOPe 2.05
  
• d2h32h1 appears in SCOPe 2.07