Lineage for d2ebya_ (2eby A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732724Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1732725Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1733172Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 1733173Protein automated matches [190907] (8 species)
    not a true protein
  7. 1733244Species Escherichia coli [TaxId:562] [255139] (1 PDB entry)
  8. 1733245Domain d2ebya_: 2eby A: [262202]
    automated match to d2ebyb_
    complexed with so4

Details for d2ebya_

PDB Entry: 2eby (more details), 2.25 Å

PDB Description: Crystal structure of a hypothetical protein from E. Coli
PDB Compounds: (A:) Putative HTH-type transcriptional regulator ybaQ

SCOPe Domain Sequences for d2ebya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebya_ a.35.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
kpttpgdillyeylepldlkinelaellhvhrnsvsalinnnrklttemafrlakvfdtt
vdfwlnlqaavdlwevennmrtqeelgrietvaeylarreer

SCOPe Domain Coordinates for d2ebya_:

Click to download the PDB-style file with coordinates for d2ebya_.
(The format of our PDB-style files is described here.)

Timeline for d2ebya_: