Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (2 families) automatically mapped to Pfam PF02203 |
Family a.24.2.0: automated matches [254222] (1 protein) not a true family |
Protein automated matches [254505] (3 species) not a true protein |
Species Escherichia coli [TaxId:562] [255106] (1 PDB entry) |
Domain d2d4ua1: 2d4u A:25-187 [262201] Other proteins in same PDB: d2d4ua2 automated match to d2d4ub_ |
PDB Entry: 2d4u (more details), 1.95 Å
SCOPe Domain Sequences for d2d4ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d4ua1 a.24.2.0 (A:25-187) automated matches {Escherichia coli [TaxId: 562]} sgglffnalknckenftvlqtirqqqstlngswvallqtrntlnragirymmdqnnigsg stvaelmesasislkqaeknwadyealprdprqstaaaaeikrnydiyhnalaeliqllg agkineffdqptqgyqdgfekqyvaymeqndrlhdiavsdnna
Timeline for d2d4ua1: