SCOPe 2.05: Domain d2d4ua_: 2d4u A:

Lineage for d2d4ua_ (2d4u A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (2 families)
   automatically mapped to Pfam PF02203

5. Family a.24.2.0: automated matches [254222] (1 protein)
   not a true family

6. Protein automated matches [254505] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255106] (1 PDB entry)

8. Domain d2d4ua_: 2d4u A: [262201]
   automated match to d2d4ub_

Details for d2d4ua_

PDB Entry: 2d4u, 1.95 Å

PDB Description: crystal structure of the ligand binding domain of the bacterial serine chemoreceptor tsr

PDB Compounds: (A:) methyl-accepting chemotaxis protein I

SCOPe Domain Sequences for d2d4ua_:

Sequence; same for both SEQRES and ATOM records:

>d2d4ua_ a.24.2.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
gplgsgglffnalknckenftvlqtirqqqstlngswvallqtrntlnragirymmdqnn
igsgstvaelmesasislkqaeknwadyealprdprqstaaaaeikrnydiyhnalaeli
qllgagkineffdqptqgyqdgfekqyvaymeqndrlhdiavsdnna

Timeline for d2d4ua_:

• d2d4ua_ is new in SCOPe 2.05-stable
  
• d2d4ua_ is called d2d4ua1 in SCOPe 2.06
  
• d2d4ua_ appears in the current release, SCOPe 2.08, called d2d4ua1