Lineage for d2d4ua1 (2d4u A:25-187)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699469Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (2 families) (S)
    automatically mapped to Pfam PF02203
  5. 2699485Family a.24.2.0: automated matches [254222] (1 protein)
    not a true family
  6. 2699486Protein automated matches [254505] (3 species)
    not a true protein
  7. 2699490Species Escherichia coli [TaxId:562] [255106] (1 PDB entry)
  8. 2699491Domain d2d4ua1: 2d4u A:25-187 [262201]
    Other proteins in same PDB: d2d4ua2
    automated match to d2d4ub_

Details for d2d4ua1

PDB Entry: 2d4u (more details), 1.95 Å

PDB Description: crystal structure of the ligand binding domain of the bacterial serine chemoreceptor tsr
PDB Compounds: (A:) methyl-accepting chemotaxis protein I

SCOPe Domain Sequences for d2d4ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d4ua1 a.24.2.0 (A:25-187) automated matches {Escherichia coli [TaxId: 562]}
sgglffnalknckenftvlqtirqqqstlngswvallqtrntlnragirymmdqnnigsg
stvaelmesasislkqaeknwadyealprdprqstaaaaeikrnydiyhnalaeliqllg
agkineffdqptqgyqdgfekqyvaymeqndrlhdiavsdnna

SCOPe Domain Coordinates for d2d4ua1:

Click to download the PDB-style file with coordinates for d2d4ua1.
(The format of our PDB-style files is described here.)

Timeline for d2d4ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d4ua2
View in 3D
Domains from other chains:
(mouse over for more information)
d2d4ub_