Lineage for d1tbq.1 (1tbq L:,H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953769Protein Thrombin [50531] (2 species)
  7. 953770Species Cow (Bos taurus) [TaxId:9913] [50533] (26 PDB entries)
    Uniprot P00734 333-622
  8. 953804Domain d1tbq.1: 1tbq L:,H: [26219]
    Other proteins in same PDB: d1tbqr1, d1tbqr2, d1tbqs1, d1tbqs2

Details for d1tbq.1

PDB Entry: 1tbq (more details), 3.1 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin
PDB Compounds: (H:) thrombin, (L:) thrombin

SCOPe Domain Sequences for d1tbq.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1tbq.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevg
lspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtr
yerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakll
hagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagy
kpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwi
qkvidrlgs

SCOPe Domain Coordinates for d1tbq.1:

Click to download the PDB-style file with coordinates for d1tbq.1.
(The format of our PDB-style files is described here.)

Timeline for d1tbq.1: