Lineage for d1tbq.1 (1tbq L:,H:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60693Protein Thrombin [50531] (2 species)
  7. 60694Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
  8. 60717Domain d1tbq.1: 1tbq L:,H: [26219]
    Other proteins in same PDB: d1tbqr1, d1tbqr2, d1tbqs1, d1tbqs2

Details for d1tbq.1

PDB Entry: 1tbq (more details), 3.1 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin

SCOP Domain Sequences for d1tbq.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1tbq.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus)}
tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevg
lspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtr
yerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakll
hagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagy
kpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwi
qkvidrlgs

SCOP Domain Coordinates for d1tbq.1:

Click to download the PDB-style file with coordinates for d1tbq.1.
(The format of our PDB-style files is described here.)

Timeline for d1tbq.1: