| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
| Protein automated matches [190301] (5 species) not a true protein |
| Species Sulfolobus solfataricus [TaxId:273057] [267761] (1 PDB entry) |
| Domain d1z6aa3: 1z6a A:1-661 [262184] automated match to d1z63a1 complexed with hg, po4 |
PDB Entry: 1z6a (more details), 3 Å
SCOPe Domain Sequences for d1z6aa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z6aa3 c.37.1.19 (A:1-661) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
lvprgshmasksfqllepynikanlrpyqikgfswmrfmnklgfgicladdmglgktlqt
iavfsdakkeneltpslvicplsvlknweeelskfaphlrfavfhedrskikledydiil
ttyavllrdtrlkevewkyivideaqniknpqtkifkavkelkskyrialtgtpienkvd
dlwsimtflnpgllgsysefkskfatpikkgdnmakeelkaiispfilrrtkydkaiind
lp
Timeline for d1z6aa3: