Lineage for d1z6aa3 (1z6a A:1-661)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1848968Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 1849175Protein automated matches [190301] (5 species)
    not a true protein
  7. 1849190Species Sulfolobus solfataricus [TaxId:273057] [267761] (1 PDB entry)
  8. 1849192Domain d1z6aa3: 1z6a A:1-661 [262184]
    automated match to d1z63a1
    complexed with hg, po4

Details for d1z6aa3

PDB Entry: 1z6a (more details), 3 Å

PDB Description: sulfolobus solfataricus swi2/snf2 atpase core domain
PDB Compounds: (A:) Helicase of the snf2/rad54 family

SCOPe Domain Sequences for d1z6aa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6aa3 c.37.1.19 (A:1-661) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
lvprgshmasksfqllepynikanlrpyqikgfswmrfmnklgfgicladdmglgktlqt
iavfsdakkeneltpslvicplsvlknweeelskfaphlrfavfhedrskikledydiil
ttyavllrdtrlkevewkyivideaqniknpqtkifkavkelkskyrialtgtpienkvd
dlwsimtflnpgllgsysefkskfatpikkgdnmakeelkaiispfilrrtkydkaiind
lp

SCOPe Domain Coordinates for d1z6aa3:

Click to download the PDB-style file with coordinates for d1z6aa3.
(The format of our PDB-style files is described here.)

Timeline for d1z6aa3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z6aa2