Lineage for d1z6aa3 (1z6a A:431-661)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870939Protein automated matches [190301] (7 species)
    not a true protein
  7. 2870966Species Sulfolobus solfataricus [TaxId:273057] [267761] (1 PDB entry)
  8. 2870968Domain d1z6aa3: 1z6a A:431-661 [262184]
    Other proteins in same PDB: d1z6aa4
    automated match to d1z63a1
    complexed with hg, po4

Details for d1z6aa3

PDB Entry: 1z6a (more details), 3 Å

PDB Description: sulfolobus solfataricus swi2/snf2 atpase core domain
PDB Compounds: (A:) Helicase of the snf2/rad54 family

SCOPe Domain Sequences for d1z6aa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6aa3 c.37.1.19 (A:431-661) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
sfqllepynikanlrpyqikgfswmrfmnklgfgicladdmglgktlqtiavfsdakken
eltpslvicplsvlknweeelskfaphlrfavfhedrskikledydiilttyavllrdtr
lkevewkyivideaqniknpqtkifkavkelkskyrialtgtpienkvddlwsimtflnp
gllgsysefkskfatpikkgdnmakeelkaiispfilrrtkydkaiindlp

SCOPe Domain Coordinates for d1z6aa3:

Click to download the PDB-style file with coordinates for d1z6aa3.
(The format of our PDB-style files is described here.)

Timeline for d1z6aa3: