Lineage for d1y8oa3 (1y8o A:174-401)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213541Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)
  6. 2213547Protein Pyruvate dehydrogenase kinase [69807] (2 species)
  7. 2213548Species Human (Homo sapiens) [TaxId:9606] [160702] (5 PDB entries)
    Uniprot Q15120 177-301
  8. 2213553Domain d1y8oa3: 1y8o A:174-401 [262181]
    Other proteins in same PDB: d1y8oa1, d1y8ob_
    automated match to d2pnrb2
    complexed with adp, k, mg, red

Details for d1y8oa3

PDB Entry: 1y8o (more details), 2.48 Å

PDB Description: Crystal structure of the PDK3-L2 complex
PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3

SCOPe Domain Sequences for d1y8oa3:

Sequence, based on SEQRES records: (download)

>d1y8oa3 d.122.1.4 (A:174-401) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
gdtnpvhpkhigsidptcnvadvvkdayetakmlceqyylvapeleveefnakapdkpiq
vvyvpshlfhmlfelfknsmratvelyedrkegypavktlvtlgkedlsikisdlgggvp
lrkidrlfnymystaprpsleptraaplagfgyglpisrlyaryfqgdlklysmegvgtd
aviylkalssesferlpvfnksawrhykttpeaddwsnpsseprdask

Sequence, based on observed residues (ATOM records): (download)

>d1y8oa3 d.122.1.4 (A:174-401) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
gdtnpvhpkhigsidptcnvadvvkdayetakmlceqyylvapeleveefnakapdkpiq
vvyvpshlfhmlfelfknsmratvelyedrkegypavktlvtlgkedlsikisdlgggvp
lrkidrlfnymysplfgyglpisrlyaryfqgdlklysmegvgtdaviylkalssesfer
lpvfnksawrhykttpeaddwsnpsseprdask

SCOPe Domain Coordinates for d1y8oa3:

Click to download the PDB-style file with coordinates for d1y8oa3.
(The format of our PDB-style files is described here.)

Timeline for d1y8oa3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y8oa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1y8ob_