Lineage for d1vrdb1 (1vrd B:1-83,B:199-457)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080657Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 2080658Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (8 species)
  7. 2080680Species Thermotoga maritima [TaxId:2336] [159378] (1 PDB entry)
    Uniprot Q9X168 1-85,213-457
  8. 2080682Domain d1vrdb1: 1vrd B:1-83,B:199-457 [262180]
    automated match to d1vrda1

Details for d1vrdb1

PDB Entry: 1vrd (more details), 2.18 Å

PDB Description: crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution
PDB Compounds: (B:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d1vrdb1:

Sequence, based on SEQRES records: (download)

>d1vrdb1 c.1.5.1 (B:1-83,B:199-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]}
mkealtfddvllvpqysevlpkdvkidtrltrqiriniplvsaamdtvteaalakalare
ggigiihknltpdeqarqvsivkXsviehpnaardekgrllvgaavgtspetmerveklv
kagvdvividtahghsrrvietlemikadypdlpvvagnvatpegtealikagadavkvg
vgpgsicttrvvagvgvpqltavmecsevarkydvpiiadggirysgdivkalaagaesv
mvgsifagteeapgetilyqgrkykayrgmgslgamrsgsadrygqegenkfvpegiegm
vpykgtvkdvvhqlvgglrsgmgyigartikelqekavfvkit

Sequence, based on observed residues (ATOM records): (download)

>d1vrdb1 c.1.5.1 (B:1-83,B:199-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]}
mkealtfddvllvpqysevlpkdvkidtrltrqiriniplvsaamdtvteaalakalare
ggigiihknltpdeqarqvsivkXsviehpnaardekgrllvgaavgtspetmerveklv
kagvdvividtahghsrrvietlemikadypdlpvvagnvatpegtealikagadavkvg
vgpgsicttrvvagvgvpqltavmecsevarkydvpiiadggirysgdivkalaagaesv
mvgsifagteeapgetilyqgrkykayrgmgiegmvpykgtvkdvvhqlvgglrsgmgyi
gartikelqekavfvkit

SCOPe Domain Coordinates for d1vrdb1:

Click to download the PDB-style file with coordinates for d1vrdb1.
(The format of our PDB-style files is described here.)

Timeline for d1vrdb1: