Lineage for d1tbr.2 (1tbr J:,K:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60693Protein Thrombin [50531] (2 species)
  7. 60694Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
  8. 60716Domain d1tbr.2: 1tbr J:,K: [26218]
    Other proteins in same PDB: d1tbrr1, d1tbrr2, d1tbrs1, d1tbrs2

Details for d1tbr.2

PDB Entry: 1tbr (more details), 2.6 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin

SCOP Domain Sequences for d1tbr.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1tbr.2 b.47.1.2 (J:,K:) Thrombin {Cow (Bos taurus)}
tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevg
lspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtr
yerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakll
hagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagy
kpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwi
qkvidrlgs

SCOP Domain Coordinates for d1tbr.2:

Click to download the PDB-style file with coordinates for d1tbr.2.
(The format of our PDB-style files is described here.)

Timeline for d1tbr.2: