![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.16: Translin [74784] (2 families) ![]() automatically mapped to Pfam PF01997 |
![]() | Family a.118.16.1: Translin [74785] (2 proteins) |
![]() | Protein automated matches [191293] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189950] (4 PDB entries) |
![]() | Domain d4wyvd1: 4wyv D:1-216 [262178] Other proteins in same PDB: d4wyvd2, d4wyve2, d4wyvg2, d4wyvh2 automated match to d1keyb_ |
PDB Entry: 4wyv (more details), 3 Å
SCOPe Domain Sequences for d4wyvd1:
Sequence, based on SEQRES records: (download)
>d4wyvd1 a.118.16.1 (D:1-216) automated matches {Human (Homo sapiens) [TaxId: 9606]} msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgagfqdipkrclk arehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavt eilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsg frllnlkndslrkrydglkydvkkveevvydlsirg
>d4wyvd1 a.118.16.1 (D:1-216) automated matches {Human (Homo sapiens) [TaxId: 9606]} msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgadipkrclkare hfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavteil giepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgfrl lnlkndslrkrydglkydvkkveevvydlsirg
Timeline for d4wyvd1: