Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.16: Translin [74784] (2 families) automatically mapped to Pfam PF01997 |
Family a.118.16.1: Translin [74785] (2 proteins) |
Protein automated matches [191293] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189950] (4 PDB entries) |
Domain d4wyvb_: 4wyv B: [262177] Other proteins in same PDB: d4wyvd2, d4wyve2, d4wyvg2, d4wyvh2 automated match to d1keyb_ |
PDB Entry: 4wyv (more details), 3 Å
SCOPe Domain Sequences for d4wyvb_:
Sequence, based on SEQRES records: (download)
>d4wyvb_ a.118.16.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgagfqdipkrclk arehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavt eilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsg frllnlkndslrkrydglkydvkkveevvydlsirgf
>d4wyvb_ a.118.16.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqdipkrclkarehf gtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavteilgi epdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgfrlln lkndslrkrydglkydvkkveevvydlsirgf
Timeline for d4wyvb_: