Lineage for d4wymg2 (4wym G:148-219)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706557Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2706558Protein automated matches [191156] (12 species)
    not a true protein
  7. 2706655Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11698] [260980] (5 PDB entries)
  8. 2706677Domain d4wymg2: 4wym G:148-219 [262170]
    Other proteins in same PDB: d4wyma1, d4wymb1, d4wymc1, d4wymd1, d4wyme1, d4wymf1, d4wymg1, d4wymh1, d4wymi1, d4wymj1, d4wymk1, d4wyml1
    automated match to d2m8pa2

Details for d4wymg2

PDB Entry: 4wym (more details), 2.6 Å

PDB Description: structural basis of hiv-1 capsid recognition by cpsf6
PDB Compounds: (G:) capsid protein p24

SCOPe Domain Sequences for d4wymg2:

Sequence, based on SEQRES records: (download)

>d4wymg2 a.28.3.0 (G:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records): (download)

>d4wymg2 a.28.3.0 (G:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqatetllvqnanpdcktilkalgpgatleemm
tacq

SCOPe Domain Coordinates for d4wymg2:

Click to download the PDB-style file with coordinates for d4wymg2.
(The format of our PDB-style files is described here.)

Timeline for d4wymg2: