Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) |
Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
Protein automated matches [191156] (12 species) not a true protein |
Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11698] [260980] (5 PDB entries) |
Domain d4wymj2: 4wym J:148-219 [262169] Other proteins in same PDB: d4wyma1, d4wymb1, d4wymc1, d4wymd1, d4wyme1, d4wymf1, d4wymg1, d4wymh1, d4wymi1, d4wymj1, d4wymk1, d4wyml1 automated match to d2m8pa2 |
PDB Entry: 4wym (more details), 2.6 Å
SCOPe Domain Sequences for d4wymj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wymj2 a.28.3.0 (J:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]} tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp gatleemmtacq
Timeline for d4wymj2: