Lineage for d4wymk1 (4wym K:1-147)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000631Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2000632Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2000633Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 protein domains)
  6. 2000672Protein HIV-1 capsid protein [47945] (1 species)
  7. 2000673Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)
  8. 2000738Domain d4wymk1: 4wym K:1-147 [262164]
    Other proteins in same PDB: d4wyma2, d4wymb2, d4wymc2, d4wymd2, d4wyme2, d4wymf2, d4wymg2, d4wymh2, d4wymj2, d4wymk2
    automated match to d2m8lb1

Details for d4wymk1

PDB Entry: 4wym (more details), 2.6 Å

PDB Description: structural basis of hiv-1 capsid recognition by cpsf6
PDB Compounds: (K:) capsid protein p24

SCOPe Domain Sequences for d4wymk1:

Sequence, based on SEQRES records: (download)

>d4wymk1 a.73.1.1 (K:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d4wymk1 a.73.1.1 (K:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhppiapgqmreprgsdiagttstlqeqigwmthnppi
pvgeiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d4wymk1:

Click to download the PDB-style file with coordinates for d4wymk1.
(The format of our PDB-style files is described here.)

Timeline for d4wymk1: