Lineage for d4wymd1 (4wym D:1-147)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717857Protein HIV-1 capsid protein [47945] (1 species)
  7. 2717858Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2717962Domain d4wymd1: 4wym D:1-147 [262160]
    Other proteins in same PDB: d4wyma2, d4wymb2, d4wymc2, d4wymd2, d4wyme2, d4wymf2, d4wymg2, d4wymh2, d4wymj2, d4wymk2
    automated match to d2m8lb1

Details for d4wymd1

PDB Entry: 4wym (more details), 2.6 Å

PDB Description: structural basis of hiv-1 capsid recognition by cpsf6
PDB Compounds: (D:) capsid protein p24

SCOPe Domain Sequences for d4wymd1:

Sequence, based on SEQRES records: (download)

>d4wymd1 a.73.1.1 (D:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d4wymd1 a.73.1.1 (D:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvpgqmreprgsdiagttstlqeqigwmthnppipv
geiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d4wymd1:

Click to download the PDB-style file with coordinates for d4wymd1.
(The format of our PDB-style files is described here.)

Timeline for d4wymd1: