SCOP 1.75: Domain d1avg.1: 1avg L:,H:

Lineage for d1avg.1 (1avg L:,H:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (26 PDB entries)
   Uniprot P00734 333-622

8. Domain d1avg.1: 1avg L:,H: [26216]
   Other proteins in same PDB: d1avgi_

Details for d1avg.1

PDB Entry: 1avg, 2.6 Å

PDB Description: thrombin inhibitor from triatoma pallidipennis

PDB Compounds: (H:) thrombin, (L:) thrombin

SCOP Domain Sequences for d1avg.1:

Sequence; same for both SEQRES and ATOM records:

>g1avg.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
ffnektfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvml
frkspqellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkveki
smldkiyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrv
tgwgnrretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrg
dacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlg
s

Timeline for d1avg.1:

• d1avg.1 first appeared (with stable ids) in SCOP 1.55
  
• d1avg.1 appears in SCOP 1.73
  
• d1avg.1 appears in SCOPe 2.01
  
• d1avg.1 appears in the current release, SCOPe 2.08